PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009522
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 307aa    MW: 34329.5 Da    PI: 5.4246
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009522genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
      Lus10009522 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.91.5e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Lus10009522  67 RGNFTPHEERMIVHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.316965IPR017930Myb domain
SuperFamilySSF466894.77E-3111108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002495.1E-161461IPR001005SANT/Myb domain
CDDcd001673.96E-111661No hitNo description
Gene3DG3DSA:1.10.10.604.4E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129419.8866116IPR017930Myb domain
SMARTSM007177.7E-1566114IPR001005SANT/Myb domain
PfamPF002497.9E-1467112IPR001005SANT/Myb domain
CDDcd001673.09E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEERMIVH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKLKNKS  120
TSVLPLTDDS SSSPPLMSFS TTRVVDLVDH TTSHFIPPIS TSTSTNTNTG TSSLPRLAAS  180
TSSMYASSTE NISRLLSVWM RKPSEQNLTN NNNVDIGNHD ELESILSFEN LNEEMSNNRI  240
KDEDHDDEEI EENEEEMKRE TKVACASSSL LPPPPPPPLS FLEKWLLDES GGGVQGEESM  300
EISSIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240570.11e-113PREDICTED: myb-related protein 306
SwissprotP813925e-88MYB06_ANTMA; Myb-related protein 306
TrEMBLM5VUV41e-110M5VUV4_PRUPE; Uncharacterized protein
STRINGVIT_08s0056g00800.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82033145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.12e-83myb domain protein 60